PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AA39G00452
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
Family MYB
Protein Properties Length: 271aa    MW: 30611.7 Da    PI: 8.373
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AA39G00452genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding59.66.8e-191461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd+llvd+++++G g+W++ +r  g+ R++k+c++rw +yl
       AA39G00452 14 KGAWTKEEDQLLVDYIRKHGEGCWRSLPRAAGLQRCGKSCRLRWMNYL 61
                     79********************************************97 PP

2Myb_DNA-binding58.12e-1867111147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg++T++Edel+++++ +lG++ W++Ia +++ gRt++++k++w+++
       AA39G00452  67 RGNFTQDEDELIIKLHSLLGNK-WSLIAGRLP-GRTDNEIKNYWNTH 111
                      89********************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.605.4E-25564IPR009057Homeodomain-like
PROSITE profilePS5129418.153961IPR017930Myb domain
SuperFamilySSF466895.03E-3112108IPR009057Homeodomain-like
SMARTSM007172.6E-141363IPR001005SANT/Myb domain
PfamPF002491.5E-161461IPR001005SANT/Myb domain
CDDcd001671.08E-111661No hitNo description
PROSITE profilePS5129428.58662116IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.6E-2865116IPR009057Homeodomain-like
SMARTSM007173.0E-1766114IPR001005SANT/Myb domain
PfamPF002491.9E-1667111IPR001005SANT/Myb domain
CDDcd001675.26E-1269112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009611Biological Processresponse to wounding
GO:0009651Biological Processresponse to salt stress
GO:0009737Biological Processresponse to abscisic acid
GO:0009751Biological Processresponse to salicylic acid
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 271 aa     Download sequence    Send to blast
MGRSPCCEKA HMNKGAWTKE EDQLLVDYIR KHGEGCWRSL PRAAGLQRCG KSCRLRWMNY  60
LRPDLKRGNF TQDEDELIIK LHSLLGNKWS LIAGRLPGRT DNEIKNYWNT HIKRKLLSRG  120
IDPQTHRIIT ASKTTSSSIL VSPQNGVVEP LQLDFTGPDL CKVIKPEPLI LEEGTKTNTN  180
NCTSSGTTSE KDIQNDDVDD WVLNLELSVG PYRCESTRKT SQGDSAESLR RWSSELSNSA  240
VCLCCRIGFE NGSCRNCRVS DVRNIRESTI L
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-29141167108B-MYB
1h8a_C1e-291211625128MYB TRANSFORMING PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00053PBMTransfer from AT1G22640Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0725431e-138AY072543.1 Arabidopsis thaliana At1g22640/F12K8.1 mRNA, complete cds.
GenBankBT0008411e-138BT000841.1 Arabidopsis thaliana At1g22640/F12K8.1 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006416177.11e-141hypothetical protein EUTSA_v10008456mg
SwissprotQ9S9K91e-142MYB3_ARATH; Transcription factor MYB3
TrEMBLV4KA551e-141V4KA55_EUTSA; Uncharacterized protein
STRINGAT1G22640.11e-139(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G22640.11e-130myb domain protein 3